DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfk and PFK6

DIOPT Version :9

Sequence 1:NP_001246234.1 Gene:Pfk / 36060 FlyBaseID:FBgn0003071 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_195010.1 Gene:PFK6 / 829420 AraportID:AT4G32840 Length:462 Species:Arabidopsis thaliana


Alignment Length:471 Identity:102/471 - (21%)
Similarity:182/471 - (38%) Gaps:124/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 EKNAVKK--------KKSAPKRKCGKSVDELRKCLRTMQDVIDFVHPVKPFKDKGLAVFTSGGDS 191
            ||..|.|        :::.|::|......::|.|                       :.|.||..
plant    63 EKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRAC-----------------------IVTCGGLC 104

  Fly   192 QGMNAAVRACVRMAIYLGCKVYFIREGYQGMVD--GGDCIQEANWA---------SVSSIIHRGG 245
            .|:|..:|..|       |.::|:    .|:.:  |.||.....::         :||.|..|||
plant   105 PGLNTVIREIV-------CGLHFM----YGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGG 158

  Fly   246 TIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTIT 310
            ||:|::     |......|..:|:..|.|..:.:|||||:..|||...:|        ::.:.:.
plant   159 TILGTS-----RGGHDTSKIVDNIQDREINQVYIIGGDGTQKGANAIYKE--------IRRRGLK 210

  Fly   311 TEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTF-IMEVMGR 374
                     :.:.|:..:||||....|.:.|.|||:.....||:|....|.|.:... |:::|||
plant   211 ---------VAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGIVKLMGR 266

  Fly   375 HCGYLSVVAGIIS-EADYVFLPESPPQADWPDRLVLKLEQE-RSAGQRLNIVIVAEGAMDREGHP 437
            :.|::::.|.:.| :.|...:||||...:....|...:.:. |..|..  ::::||||    |..
plant   267 YSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHM--VIVIAEGA----GQD 325

  Fly   438 ITAEDVK-------------------KVIDERLKHDARITVLGHVQ-----RGGNPSAFDRILAC 478
            :.||.::                   |:.:...||:.....|.::.     |....:|.|.:.:.
plant   326 LVAESIEQQDASGNKLLKDVGLWMSLKIKEYFAKHNVMDITLKYIDPTYMIRAIPANASDNVYST 390

  Fly   479 RMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFE 543
            .:...|....|......|..:::   .:...:|.....||...|  .:.::.||           
plant   391 LLAQSAVHGAMAGYTGFVSGLVN---GRHTYIPFNRITERQNKV--VITDRMWA----------- 439

  Fly   544 RNLETYKMLTRLKPPK 559
            |.|.:....:.:.|||
plant   440 RMLSSTNQPSFMNPPK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfkNP_001246234.1 PFK 178..914 CDD:294137 94/420 (22%)
6PF1K_euk 180..929 CDD:274152 94/418 (22%)
PFK6NP_195010.1 PLN02564 9..462 CDD:178178 102/471 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2941
eggNOG 1 0.900 - - E1_COG0205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000489
OrthoInspector 1 1.000 - - otm2441
orthoMCL 1 0.900 - - OOG6_100319
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.