DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfk and PFK5

DIOPT Version :9

Sequence 1:NP_001246234.1 Gene:Pfk / 36060 FlyBaseID:FBgn0003071 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_850025.1 Gene:PFK5 / 816781 AraportID:AT2G22480 Length:537 Species:Arabidopsis thaliana


Alignment Length:431 Identity:105/431 - (24%)
Similarity:176/431 - (40%) Gaps:86/431 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CIKLRSDSGDQKNDSPGEKNIQKDKSAQRCGKPINNLHNGFLNAVNYSEKNAVKKKKSAPKRKCG 151
            |:|:||.:.|.....|         |.:.....|||.....|..::|          |:|.....
plant   105 CLKMRSPTEDFVGGYP---------SDEEWHGYINNNDRVLLKVISY----------SSPTSAGA 150

  Fly   152 KSVDELRKCLRTMQDVIDFVHPVKP-----FKDKGL--AVFTSGGDSQGMNAAVR-ACVRMAIYL 208
            :.:|  ..|....|    ::|...|     |:.:.:  |:.|.||...|:|..:| ..:.:.||.
plant   151 ECLD--HDCSWVEQ----WIHRAGPREKIYFRPEEVKAAIITCGGLCPGLNDVIRHIVITLEIYG 209

  Fly   209 GCKVYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRG 273
            ...:..|..||:|..|........:...|.:|...||:::|.:     |......:..:::.:||
plant   210 VKNIVGIPFGYRGFSDKDLTEMPLSRKVVQNIHLSGGSLLGVS-----RGGPSVSEIVDSMEERG 269

  Fly   274 ITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDM 338
            |..|.|:||:|:..|||....|.                ::.|..|. :||:..:||||....|.
plant   270 INMLFVLGGNGTHAGANAIHNEC----------------RKRKIKVA-VVGVPKTIDNDILHMDK 317

  Fly   339 TIGTDTALHRIIEAIDAISSTAYS-HQRTFIMEVMGRHCGYLSVVAGIIS-EADYVFLPESPPQA 401
            |.|.|||:.....||::....|:| :....::::|||:.|::::.|.:.| :.|...:||.|...
plant   318 TFGFDTAVEEAQRAINSAYIEAHSAYHGIGVVKLMGRNSGFIAMQASLASGQVDICLIPEVPFNL 382

  Fly   402 DWPDRLVLK-----LEQERSAGQRLNIVIVAEG----------AMDREGHPITA-------EDVK 444
            ..|:. |||     :|.:.||     ::.||||          |.|..|:.:..       ::.|
plant   383 HGPNG-VLKHLKYLIETKGSA-----VICVAEGAGQNFLEKTNAKDASGNAVLGDFGVYIQQETK 441

  Fly   445 KVIDE-RLKHDARITVLGHVQRGGNPSAFDRILACRMGAEA 484
            |...| ....|.:.....::.|....:|.|.||...:|..|
plant   442 KYFKEISTPIDVKYIDPTYMIRAVRANASDGILCTVLGQNA 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfkNP_001246234.1 PFK 178..914 CDD:294137 85/335 (25%)
6PF1K_euk 180..929 CDD:274152 85/333 (26%)
PFK5NP_850025.1 PLN02884 127..537 CDD:178472 98/400 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2941
eggNOG 1 0.900 - - E1_COG0205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000489
OrthoInspector 1 1.000 - - otm2441
orthoMCL 1 0.900 - - OOG6_100319
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.