DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and GRF10

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_564167.1 Gene:GRF10 / 838837 AraportID:AT1G22300 Length:254 Species:Arabidopsis thaliana


Alignment Length:249 Identity:153/249 - (61%)
Similarity:193/249 - (77%) Gaps:9/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            ::|:.|..|||:||:||||:|.:|||.|.:..|||:.|||||:||.||||:||||:|||::||||
plant     4 EREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASWRILSSIE 68

  Fly    70 QKTEASARKQQLAR--EYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYL 132
            ||.|:....:.:.|  .||:|||.||.::|.::|.::||:|||.::..||.||:.||||||||||
plant    69 QKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYL 133

  Fly   133 AEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 197
            ||.::|..|....|.|..||:.|...::..:.||||:|||||||||||||||||||:.|||||||
plant   134 AEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYYEILNSPESACQLAKQ 198

  Fly   198 AFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSD--TQGDEA-----EPQE 244
            ||||||||||:|||:||||||||||||||||||||||  .:|||.     |||:
plant   199 AFDDAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEGDERTKGADEPQD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 145/230 (63%)
GRF10NP_564167.1 14-3-3 11..232 CDD:395187 140/220 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.