DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and GRF8

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001190621.1 Gene:GRF8 / 836668 AraportID:AT5G65430 Length:260 Species:Arabidopsis thaliana


Alignment Length:241 Identity:149/241 - (61%)
Similarity:188/241 - (78%) Gaps:7/241 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STVDKEELVQKAKLAEQSERYDDMAQAMKSV----TETGVELSNEERNLLSVAYKNVVGARRSSW 62
            :|:.:::.|..||||||:|||::|.|.|:.:    |..| ||:.|||||||||||||:|:.|::|
plant     3 TTLSRDQYVYMAKLAEQAERYEEMVQFMEQLVSGATPAG-ELTVEERNLLSVAYKNVIGSLRAAW 66

  Fly    63 RVISSIEQKTEASARKQ--QLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMK 125
            |::||||||.|:...::  .|.::||.:||.||..||..:|.|||.:|||.|:..||||||||||
plant    67 RIVSSIEQKEESRKNEEHVSLVKDYRSKVETELSSICSGILRLLDSHLIPSATASESKVFYLKMK 131

  Fly   126 GDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDK 190
            |||:|||||..:||.|.|..:|:..||:.|.|::...:.|||||||||||||||||||||||.:|
plant   132 GDYHRYLAEFKSGDERKTAAEDTMIAYKAAQDVAVADLAPTHPIRLGLALNFSVFYYEILNSSEK 196

  Fly   191 ACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQ 236
            ||.:|||||::||||||||.|:||||||||||||||||||||||.|
plant   197 ACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 145/234 (62%)
GRF8NP_001190621.1 14-3-3 7..242 CDD:295170 147/235 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.