DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and GRF3

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_568557.1 Gene:GRF3 / 833836 AraportID:AT5G38480 Length:255 Species:Arabidopsis thaliana


Alignment Length:257 Identity:161/257 - (62%)
Similarity:194/257 - (75%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTET--GVELSNEERNLLSVAYKNVVGARRSSWR 63
            |||  :||.|..||||||:|||::|.:.|:.|.:|  ..|||.|||||||||||||:||||:|||
plant     1 MST--REENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELSVEERNLLSVAYKNVIGARRASWR 63

  Fly    64 VISSIEQKTEASARKQQLA--REYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKG 126
            :|||||||.|:...:..:|  ::||.::|.||.:||..:|.:|:.:|||.||..|||||||||||
plant    64 IISSIEQKEESKGNEDHVAIIKDYRGKIESELSKICDGILNVLEAHLIPSASPAESKVFYLKMKG 128

  Fly   127 DYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKA 191
            ||:|||||...|..|....:.:..||:.|.||:..::.|||||||||||||||||||||||||:|
plant   129 DYHRYLAEFKAGAERKEAAESTLVAYKSASDIATAELAPTHPIRLGLALNFSVFYYEILNSPDRA 193

  Fly   192 CQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS---DTQGD---EAEPQEGGD 247
            |.||||||||||||||||.|:|||||||||||||||||||||   |..||   ||...:|.:
plant   194 CSLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPDGAE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 152/235 (65%)
GRF3NP_568557.1 14-3-3 4..240 CDD:413191 152/235 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.