DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and GRF6

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001190276.1 Gene:GRF6 / 830909 AraportID:AT5G10450 Length:273 Species:Arabidopsis thaliana


Alignment Length:244 Identity:150/244 - (61%)
Similarity:188/244 - (77%) Gaps:7/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGV----ELSNEERNLLSVAYKNVVGARRSSW 62
            :|:.:::.|..||||||:|||::|.|.|:.:. ||.    ||:.|||||||||||||:|:.|::|
plant     3 ATLGRDQYVYMAKLAEQAERYEEMVQFMEQLV-TGATPAEELTVEERNLLSVAYKNVIGSLRAAW 66

  Fly    63 RVISSIEQKTEASARKQ--QLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMK 125
            |::||||||.|:....:  .|.::||.:||.||..:|..:|.|||.:|||.|...||||||||||
plant    67 RIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMK 131

  Fly   126 GDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDK 190
            |||:||:||..:||.|.|..:|:..||:.|.||:...|.|||||||||||||||||||||||.||
plant   132 GDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDK 196

  Fly   191 ACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDE 239
            ||.:|||||::||||||||.|:||||||||||||||||||||||.|.::
plant   197 ACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQTNQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 146/234 (62%)
GRF6NP_001190276.1 14-3-3 7..242 CDD:295170 148/235 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.