DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and GRF7

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001327587.1 Gene:GRF7 / 821060 AraportID:AT3G02520 Length:265 Species:Arabidopsis thaliana


Alignment Length:254 Identity:157/254 - (61%)
Similarity:190/254 - (74%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KEELVQKAKLAEQSERYDDMAQAMKSVTET--GVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68
            :||.|..||||||:|||::|.:.|:.|.:|  ..||:.|||||||||||||:||||:|||:||||
plant     5 REENVYLAKLAEQAERYEEMVEFMEKVAKTVDTDELTVEERNLLSVAYKNVIGARRASWRIISSI 69

  Fly    69 EQKTEASARKQQLA--REYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRY 131
            |||.|:......::  ::||.::|.||.:||..:|.|||.:|:|.||..|||||||||||||:||
plant    70 EQKEESRGNDDHVSIIKDYRGKIETELSKICDGILNLLDSHLVPTASLAESKVFYLKMKGDYHRY 134

  Fly   132 LAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAK 196
            |||..||..|....:.:..||:.|.||:...:.|||||||||||||||||||||||||:||.|||
plant   135 LAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACSLAK 199

  Fly   197 QAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQ----GDEA------EPQEG 245
            ||||:||:|||||.|:|||||||||||||||||||.||..    |||.      ||:||
plant   200 QAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWNSDINDEAGGDEIKEASKHEPEEG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 148/231 (64%)
GRF7NP_001327587.1 14-3-3 5..241 CDD:413191 150/235 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - LDO PTHR18860
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.