DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and GRF9

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001031533.1 Gene:GRF9 / 818859 AraportID:AT2G42590 Length:276 Species:Arabidopsis thaliana


Alignment Length:256 Identity:150/256 - (58%)
Similarity:191/256 - (74%) Gaps:12/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            :::..|..|||:||:|||::|.::||||.:..|:|:.||||||||.||||:|:||:|||:.||||
plant     6 ERDTFVYLAKLSEQAERYEEMVESMKSVAKLNVDLTVEERNLLSVGYKNVIGSRRASWRIFSSIE 70

  Fly    70 QKTEASARKQQLAR--EYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYL 132
            ||.........:.|  ||.|:||.||..||.:::.:||::|||.||..||.||:.||||||||||
plant    71 QKEAVKGNDVNVKRIKEYMEKVELELSNICIDIMSVLDEHLIPSASEGESTVFFNKMKGDYYRYL 135

  Fly   133 AEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 197
            ||..:|:.|....|.|..||:.|...::.|:.||||||||||||||||||||:|:|::||.||||
plant   136 AEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNFSVFYYEIMNAPERACHLAKQ 200

  Fly   198 AFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQ---GDE-------AEPQEGGDN 248
            |||:||:|||||||:||||||||||||||||||||||..   ||:       |:|..|||:
plant   201 AFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISEEGGDDAHKTNGSAKPGAGGDD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 141/230 (61%)
GRF9NP_001031533.1 14-3-3 11..237 CDD:278665 141/225 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.