DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and ywhag

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001072309.1 Gene:ywhag / 779762 XenbaseID:XB-GENE-951350 Length:247 Species:Xenopus tropicalis


Alignment Length:248 Identity:181/248 - (72%)
Similarity:206/248 - (83%) Gaps:9/248 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68
            ||:|:|||||:||||:|||||||.|||:|||....||||||||||||||||||||||||||||||
 Frog     2 VDREQLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSI 66

  Fly    69 EQKTEA--SARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNP--ESKVFYLKMKGDYY 129
            ||||.|  :.:|.::.|.|||::||||..:|.:||.|||.:||...|..  ||||||||||||||
 Frog    67 EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNFLIKNCSETQYESKVFYLKMKGDYY 131

  Fly   130 RYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQL 194
            |||||||||:.|.|||:.|:.||.:|.:|||..||||||||||||||:|||||||.|:|::||.|
 Frog   132 RYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHL 196

  Fly   195 AKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGD 247
            ||.|||||||||||||||||||||||||||||||||||||.|.|     :||:
 Frog   197 AKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD-----DGGE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 174/232 (75%)
ywhagNP_001072309.1 14-3-3_gamma 2..247 CDD:206760 181/248 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.