DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and YWHAH

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_003396.1 Gene:YWHAH / 7533 HGNCID:12853 Length:246 Species:Homo sapiens


Alignment Length:240 Identity:176/240 - (73%)
Similarity:209/240 - (87%) Gaps:4/240 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            |:|:|:|:|:||||:|||||||.|||:|||....||||:||||||||||||||||||||||||||
Human     3 DREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIE 67

  Fly    70 QKTEASARKQQL--AREYRERVEKELREICYEVLGLLDKYLIPKASN--PESKVFYLKMKGDYYR 130
            |||.|...:::|  .:.|||::||||..:|.:||.||||:||...::  .|||||||||||||||
Human    68 QKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYR 132

  Fly   131 YLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLA 195
            ||||||:|:.:|:||:.|:.||::||:|||.:||||||||||||||||||||||.|:|::||.||
Human   133 YLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLA 197

  Fly   196 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEA 240
            |||||||||||||||||||||||||||||||||||||||.|.:||
Human   198 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 171/232 (74%)
YWHAHNP_003396.1 14-3-3_eta 3..241 CDD:206761 174/237 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.