DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and ywhah

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001016868.1 Gene:ywhah / 549622 XenbaseID:XB-GENE-949031 Length:247 Species:Xenopus tropicalis


Alignment Length:239 Identity:170/239 - (71%)
Similarity:202/239 - (84%) Gaps:4/239 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            |:|:|:|:|:||||:|||:|||.|||||||....||||:||||||||||||||||||||||||||
 Frog     3 DREQLLQRARLAEQAERYEDMAAAMKSVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIE 67

  Fly    70 QKTEASARKQQL--AREYRERVEKELREICYEVLGLLDKYLIPKASN--PESKVFYLKMKGDYYR 130
            |||.|...:::|  .:.|||::|.||..:|.|||.||||:||...::  .|||||||||||||||
 Frog    68 QKTLADGNEKKLEKVKAYREKIEAELEAVCSEVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYR 132

  Fly   131 YLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLA 195
            ||:||.:|:.:.:|.:.|:.||::||:|||..||||||||||||||||||||||..:|::||.||
 Frog   133 YLSEVGSGERKRSVTEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQGNPEQACLLA 197

  Fly   196 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDE 239
            |||||||||||||||||||||||||||||||||||||||.|.:|
 Frog   198 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 166/232 (72%)
ywhahNP_001016868.1 14-3-3_eta 3..241 CDD:206761 169/237 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.