DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and ywhae2

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001013359.1 Gene:ywhae2 / 503763 ZFINID:ZDB-GENE-050306-44 Length:255 Species:Danio rerio


Alignment Length:247 Identity:167/247 - (67%)
Similarity:200/247 - (80%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            |:|.||.:||||||:||||:|.::||:|.....:||.|||||||||||||:||||:|||:|||||
Zfish     3 DREHLVYQAKLAEQAERYDEMVESMKNVAGKDEDLSVEERNLLSVAYKNVIGARRASWRIISSIE 67

  Fly    70 QKTEA--SARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYL 132
            ||.|:  .|.|.::.||||:.||.||:.||.::|.:|||:|||.|:..||||||.||||||:|||
Zfish    68 QKEESKGGADKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYL 132

  Fly   133 AEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 197
            ||.|||:.|....::|..||:.|.||:..::.|||||||||||||||||||||||||:||:|||.
Zfish   133 AEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197

  Fly   198 AFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE-----PQE 244
            ||||||||||||:||||||||||||||||||||||||.|||..|     ||:
Zfish   198 AFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDIQGDGEEQSKTAPQD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 159/230 (69%)
ywhae2NP_001013359.1 14-3-3 4..233 CDD:295170 157/228 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1059
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.