DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and ywhah

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_998329.1 Gene:ywhah / 406443 ZFINID:ZDB-GENE-040426-2191 Length:246 Species:Danio rerio


Alignment Length:247 Identity:178/247 - (72%)
Similarity:202/247 - (81%) Gaps:10/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            |:|:|:|:|:||||:|||||||.|||.|||....||||:||||||||||||||||||||||||||
Zfish     3 DREQLIQRARLAEQAERYDDMASAMKLVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIE 67

  Fly    70 QKTEA--SARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKA--SNPESKVFYLKMKGDYYR 130
            |||.|  :.:|.:|.|.|||.|||||..:|.:||.|||:|||...  :..|||||||||||||||
Zfish    68 QKTAADGNEKKLELVRVYRETVEKELESVCQDVLTLLDQYLIKNCDETQVESKVFYLKMKGDYYR 132

  Fly   131 YLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLA 195
            ||||||||:.|.:.|:.|:.||::||||||| |..|||||||||||||||||||.|:|::|||||
Zfish   133 YLAEVATGEKRASAVESSEGAYKEAFDISKG-MPATHPIRLGLALNFSVFYYEIQNAPEQACQLA 196

  Fly   196 KQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGD 247
            |:||||||..||.||||||||||||||||||||||||||.|     ..||||
Zfish   197 KEAFDDAIGHLDNLNEDSYKDSTLIMQLLRDNLTLWTSDQQ-----DSEGGD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 171/232 (74%)
ywhahNP_998329.1 14-3-3 3..246 CDD:295170 178/247 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.