DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and ywhae1

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_997770.1 Gene:ywhae1 / 322060 ZFINID:ZDB-GENE-030131-779 Length:255 Species:Danio rerio


Alignment Length:239 Identity:165/239 - (69%)
Similarity:196/239 - (82%) Gaps:2/239 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69
            |:|:||.:||||||:||||:|..:||.|....|||:.|||||||||||||:||||:|||:|||||
Zfish     3 DREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIE 67

  Fly    70 QKTE--ASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYL 132
            ||.|  ....|.::.||||:.||.||:.||.::|.:|||:|||.|::.||||||.||||||:|||
Zfish    68 QKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYL 132

  Fly   133 AEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 197
            ||.|||:.|....::|..||:.|.||:...:||||||||||||||||||||||||||:||:|||.
Zfish   133 AEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197

  Fly   198 AFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241
            ||||||||||||:|:||||||||||||||||||||||.|||..|
Zfish   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 159/230 (69%)
ywhae1NP_997770.1 14-3-3_epsilon 4..233 CDD:206757 157/228 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1059
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.