DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and ywhabl

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_955856.1 Gene:ywhabl / 321729 ZFINID:ZDB-GENE-030131-448 Length:245 Species:Danio rerio


Alignment Length:245 Identity:188/245 - (76%)
Similarity:222/245 - (90%) Gaps:0/245 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68
            :||.|||||||||||:|||||||.|||:|||..:|||||||||||||||||||||||||||:|||
Zfish     1 MDKSELVQKAKLAEQAERYDDMAAAMKAVTEGDIELSNEERNLLSVAYKNVVGARRSSWRVVSSI 65

  Fly    69 EQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLA 133
            |||.|.|.:|||:.:||||::||||:|||.:||.||||||||||:..||:||||||||||:||||
Zfish    66 EQKMEGSDKKQQMVKEYREKIEKELKEICNDVLVLLDKYLIPKATPAESRVFYLKMKGDYFRYLA 130

  Fly   134 EVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQA 198
            |||.|:.:|:::.:||.||:|||:|||.:||||||||||||||||||||||||||::||:|||.|
Zfish   131 EVAVGEEKNSIIGNSQEAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTA 195

  Fly   199 FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN 248
            ||:||||||:|||:||||||||||||||||||||||.||:..:.:||.:|
Zfish   196 FDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDNQGEGEDAEEGREN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 181/228 (79%)
ywhablNP_955856.1 14-3-3 2..230 CDD:295170 180/227 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 370 1.000 Domainoid score I860
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56528
Inparanoid 1 1.050 395 1.000 Inparanoid score I1921
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 1 1.000 - - otm25005
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.