DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and LOC298795

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001013963.1 Gene:LOC298795 / 298795 RGDID:1359510 Length:248 Species:Rattus norvegicus


Alignment Length:247 Identity:162/247 - (65%)
Similarity:195/247 - (78%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68
            :::..|:||||||||:|||:|||..|||..|.|.|||.|||||||||||||||.:||:|||:|||
  Rat     1 MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSFEERNLLSVAYKNVVGGQRSAWRVLSSI 65

  Fly    69 EQK--TEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRY 131
            |||  .|.|..|....:||||:||.|||.:|..||||||.:||..|...||:|||||||||||||
  Rat    66 EQKINEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGEAESRVFYLKMKGDYYRY 130

  Fly   132 LAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAK 196
            ||||||||.:..::|.:::|||:|.||||.:|.||:|||||||||||||:|||.|.|::|..|||
  Rat   131 LAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANRPEEAISLAK 195

  Fly   197 QAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEA-----EPQ 243
            ..||:|:|:|.||:||||||||||||||||||||||::..|:|.     |||
  Rat   196 TTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTAENAGEEGGEAPEEPQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 157/230 (68%)
LOC298795NP_001013963.1 14-3-3 1..234 CDD:295170 157/232 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.