DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3zeta and M117.3

DIOPT Version :9

Sequence 1:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_502236.1 Gene:M117.3 / 187477 WormBaseID:WBGene00010919 Length:125 Species:Caenorhabditis elegans


Alignment Length:134 Identity:50/134 - (37%)
Similarity:70/134 - (52%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MKGDYYRYLAEVATGDARNTVVDD---------SQTAYQDAFDISKGKMQPTHPIRLGLALNFSV 179
            |..|::|||.:          .||         |:.|||:|..|:|.|||||||||||||||.|.
 Worm     1 MVADHFRYLVQ----------YDDINREEHAHKSRIAYQEALGIAKDKMQPTHPIRLGLALNASA 55

  Fly   180 FYYEILNSPDKACQLAKQAFDDAIAELDTLNE--DSYKDSTL-----IMQLLRDNLTLWTSDTQG 237
            ..:::||.|.:|.::|:.|.|.|..||:.:..  |||..|.|     :..||:..........:|
 Worm    56 LNFDVLNLPKEANEIAQSALDSAHRELEKMKSSLDSYDISNLKRARTLYDLLKSTHEQRVDGKEG 120

  Fly   238 DEAE 241
            :||:
 Worm   121 EEAD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 47/125 (38%)
M117.3NP_502236.1 14-3-3 <1..97 CDD:382840 44/105 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.