DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0-like and Mrto4-ps2

DIOPT Version :9

Sequence 1:NP_610554.1 Gene:RpLP0-like / 36058 FlyBaseID:FBgn0033485 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_036013639.1 Gene:Mrto4-ps2 / 434693 MGIID:3779507 Length:239 Species:Mus musculus


Alignment Length:245 Identity:135/245 - (55%)
Similarity:177/245 - (72%) Gaps:6/245 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRSKRDKKVSLTKTDRKGLAWKQRIVDDIRFCVGKYPNIFVFQVQNMRNSLLKDLRQELKKNSR 65
            ||:||||||||||||.:|||..||.:::::|.||..|..:|:|.|.|||||.|||:|... |:||
Mouse     1 MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAW-KHSR 64

  Fly    66 FIFGKNRVMQIGLGRTKSEEVEPELHKLSKRLTGQVGLLFTDKSKEEVLEWAENYWAVEYARSGF 130
            ..||||:||.:.|||:.|:|.:.:||::||:|.|:||||||:::||||.||...|..:::||:|.
Mouse    65 MFFGKNKVMMVALGRSPSDEYKDDLHQVSKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGN 129

  Fly   131 VATETVTLPAGPLEDFAHSMEPHLRSLGLPTKLEKGIVTLYSDYTVCEEGKVLTPEQARILKLVG 195
            .||.||:|..|||:.|.||||..||.|||||.||||:|||.|||.||:||.||||||||||||.|
Mouse   130 KATLTVSLDPGPLKQFPHSMELQLRQLGLPTALEKGVVTLLSDYEVCKEGDVLTPEQARILKLFG 194

  Fly   196 KPMAKFRLTMKCSWTKSEGFQLHVEDDVNDEEQADSAMEEEAEAEAMDDN 245
            ..||:|::|:|..|....|....::||:     .:||.|.|.|:|..||:
Mouse   195 YEMAEFKVTIKYMWDAQSGQFQQMDDDL-----PESAPESEGESEEEDDS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0-likeNP_610554.1 Ribosomal_P0_like 21..184 CDD:240222 89/162 (55%)
Mrto4-ps2XP_036013639.1 Ribosomal_P0_like 21..183 CDD:240222 89/162 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6379
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.