DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0-like and RpLP0

DIOPT Version :9

Sequence 1:NP_610554.1 Gene:RpLP0-like / 36058 FlyBaseID:FBgn0033485 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster


Alignment Length:316 Identity:64/316 - (20%)
Similarity:116/316 - (36%) Gaps:93/316 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AWKQRIVDDIRFCVGKYPNIFVFQVQNMRNSLLKDLRQELKKNSRFIFGKNRVMQIGL-GRTKSE 84
            |||.:....:.....::|..|:....|:.:..::::|..|:..:..:.|||.:|:..: |..   
  Fly     8 AWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHL--- 69

  Fly    85 EVEPELHKLSKRLTGQVGLLFTDKSKEEVLEWAENYWAVEYARSGFVATETVTLPA-----GPLE 144
            |..|:|.||...:.|.||.:||.....||.:..........||.|.:|...|.:||     ||  
  Fly    70 ENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGP-- 132

  Fly   145 DFAHSMEPHLRSLGLPTKLEKGIVTLYSDYTVCEEGKVLTPEQARILKLVG-------------- 195
                ......::|.:|||:.||.:.:.:|..:.:.|..:...:|.:|.::.              
  Fly   133 ----EKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVY 193

  Fly   196 -------------KP---MAKFR-----LTMKC-----------SWTKSEGFQ------------ 216
                         ||   .|||:     |...|           ..:.:.||:            
  Fly   194 DSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVE 258

  Fly   217 ----LHVEDDVNDEEQ------------ADSAMEEEAEAEAMDDNDDDDDEEEDDE 256
                ..:::.:.|..:            |..|.|::.||:    ..:.:.|||||:
  Fly   259 FKEATTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAK----KPESESEEEDDD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0-likeNP_610554.1 Ribosomal_P0_like 21..184 CDD:240222 42/168 (25%)
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 54/275 (20%)
Ribosomal_P0_L10e 8..182 CDD:240221 44/182 (24%)
Ribosomal_60s 232..>285 CDD:278836 3/52 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.