DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0-like and rplp0

DIOPT Version :9

Sequence 1:NP_610554.1 Gene:RpLP0-like / 36058 FlyBaseID:FBgn0033485 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_012813704.1 Gene:rplp0 / 394664 XenbaseID:XB-GENE-976211 Length:315 Species:Xenopus tropicalis


Alignment Length:110 Identity:28/110 - (25%)
Similarity:51/110 - (46%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LHKLSKRLTGQVGLLFTDKSKEEVLEWAENYWAVEYARSGFVATETVTLPA-----GPLEDFAHS 149
            |::|...:.|.||.:||.:...||.:..........||:|.:|...|.:||     ||      .
 Frog    76 LYRLLSHIKGNVGFVFTKEDLTEVRDMLLANKVPACARAGAIAPCGVVVPAQNTGLGP------E 134

  Fly   150 MEPHLRSLGLPTKLEKGIVTLYSDYTVCEEGKVLTPEQARILKLV 194
            .....::||:.||:.:|.:.:.||..:.:.|..:...:|.:|.::
 Frog   135 KTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNML 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0-likeNP_610554.1 Ribosomal_P0_like 21..184 CDD:240222 26/98 (27%)
rplp0XP_012813704.1 Ribosomal_L10_P0 <76..315 CDD:381979 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.