DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0-like and rla-0

DIOPT Version :9

Sequence 1:NP_610554.1 Gene:RpLP0-like / 36058 FlyBaseID:FBgn0033485 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_492766.1 Gene:rla-0 / 172943 WormBaseID:WBGene00004408 Length:312 Species:Caenorhabditis elegans


Alignment Length:234 Identity:50/234 - (21%)
Similarity:101/234 - (43%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTKTDRKGLAWKQRIVDDIRFCVGKYPNIFVFQVQNMRNSLLKDLRQELKKNSRFIFGKN----R 72
            :.:.||.  .||......:.....:||...:..|.|:.:..::::||.::.::..:.|||    :
 Worm     1 MVREDRS--TWKANYFTKLVELFEEYPKCLLVGVDNVGSKQMQEIRQAMRGHAEILMGKNTMIRK 63

  Fly    73 VMQIGLGRTKSEEVEPELHKLSKRLTGQVGLLFTDKSKEEV-LEWAENYWAVEYARSGFVATETV 136
            .::..||:      .|.|.||...:...||.:||.:...|: .:..||..... |::|.:|...|
 Worm    64 ALRGHLGK------NPSLEKLLPHIVENVGFVFTKEDLGEIRSKLLENRKGAP-AKAGAIAPCDV 121

  Fly   137 TLP-----AGPLEDFAHSMEPHLRSLGLPTKLEKGIVTLYSDYTVCEEGKVLTPEQARILKLVGK 196
            .||     .||      ......::|.:|||:.:|.:.:.:|..:.:||..:...::.:|.::|.
 Worm   122 KLPPQNTGMGP------EKTSFFQALQIPTKIARGTIEILNDVHLIKEGDKVGASESALLNMLGV 180

  Fly   197 PMAKFRLTMKCSWTKSEGFQLHVEDDVNDEEQADSAMEE 235
            ....:.|.::         |::.:..:...|..|...||
 Worm   181 TPFSYGLVVR---------QVYDDGTLYTPEVLDMTTEE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0-likeNP_610554.1 Ribosomal_P0_like 21..184 CDD:240222 40/172 (23%)
rla-0NP_492766.1 PTZ00135 1..312 CDD:240285 50/234 (21%)
Ribosomal_P0_L10e 9..182 CDD:240221 42/185 (23%)
Ribosomal_60s 232..311 CDD:278836
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.