DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0-like and Rplp0

DIOPT Version :9

Sequence 1:NP_610554.1 Gene:RpLP0-like / 36058 FlyBaseID:FBgn0033485 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_031501.1 Gene:Rplp0 / 11837 MGIID:1927636 Length:317 Species:Mus musculus


Alignment Length:222 Identity:55/222 - (24%)
Similarity:95/222 - (42%) Gaps:48/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRSKRDKKVSLTKTDRKGLAWKQ-------RIVDDIRFCVGKYPNIFVFQVQNMRNSLLKDLRQ 58
            |||..|             ..||.       :::||       ||..|:....|:.:..::.:|.
Mouse     1 MPREDR-------------ATWKSNYFLKIIQLLDD-------YPKCFIVGADNVGSKQMQQIRM 45

  Fly    59 ELKKNSRFIFGKNRVMQIGL-GRTKSEEVEPELHKLSKRLTGQVGLLFTDKSKEEVLEWAENYWA 122
            .|:..:..:.|||.:|:..: |..   |..|.|.||...:.|.||.:||   ||::.|..:...|
Mouse    46 SLRGKAVVLMGKNTMMRKAIRGHL---ENNPALEKLLPHIRGNVGFVFT---KEDLTEIRDMLLA 104

  Fly   123 VEY---ARSGFVATETVTLPA-----GPLEDFAHSMEPHLRSLGLPTKLEKGIVTLYSDYTVCEE 179
            .:.   ||:|.:|...||:||     ||      ......::||:.||:.:|.:.:.||..:.:.
Mouse   105 NKVPAAARAGAIAPCEVTVPAQNTGLGP------EKTSFFQALGITTKISRGTIEILSDVQLIKT 163

  Fly   180 GKVLTPEQARILKLVGKPMAKFRLTMK 206
            |..:...:|.:|.::......|.|.::
Mouse   164 GDKVGASEATLLNMLNISPFSFGLIIQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0-likeNP_610554.1 Ribosomal_P0_like 21..184 CDD:240222 47/178 (26%)
Rplp0NP_031501.1 PTZ00135 1..275 CDD:240285 55/222 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.