DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and SKO1

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_014232.1 Gene:SKO1 / 855554 SGDID:S000005111 Length:647 Species:Saccharomyces cerevisiae


Alignment Length:480 Identity:100/480 - (20%)
Similarity:157/480 - (32%) Gaps:174/480 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VSAAANLSIQNAGSSGATAIQIIPKTEPV-----GEEGPMSLDFQSP----NLNTSTPNPNK--- 57
            ||:.:.....|:.|...|::...|:...|     |...|.: |.|.|    ||:.|...||:   
Yeast   158 VSSTSGSLYPNSSSPSGTSLIRQPRNSNVTTSNSGNGFPTN-DSQMPGFLLNLSKSGLTPNESNI 221

  Fly    58 ----RPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKA 118
                .||.|    ..:.|..:. |.:..:....||.||    :.:.::.::...|....:.||..
Yeast   222 RTGLTPGIL----TQSYNYPVL-PSINKNTITGSKNVN----KSVTVNGSIENHPHVNIMHPTVN 277

  Fly   119 G-PVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMT--AVNNGISGGTFTYT 180
            | |:|       .|....|:        .||....||....:|.....|  .|||.||...|:..
Yeast   278 GTPLT-------PGLSSLLN--------LPSTGVLANPVFKSTPTTNTTDGTVNNSISNSNFSPN 327

  Fly   181 NMTEGFSVIKDEPV--------------------------------------------------- 194
            ..|:. :|..|.|.                                                   
Yeast   328 TSTKA-AVKMDNPAEFNAIEHSAHNHKENENLTTQIENNDQFNNKTRKRKRRMSSTSSTSKASRK 391

  Fly   195 ----NQASSPTVNPIDMEAQEKIKL------------ERKR----QRNRVAASKCRKRKLERISK 239
                .:.|:.|..|...:..|..|:            ||||    :||||||||.||||.|.|.|
Yeast   392 NSISRKNSAVTTAPAQKDDVENNKISNNVTLDENEEQERKRKEFLERNRVAASKFRKRKKEYIKK 456

  Fly   240 LEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQXHLELSAGENDEEDV 304
            :|:.::..:.|..||..::..|                  |.:.|:|:          .|.:.:|
Yeast   457 IENDLQFYESEYDDLTQVIGKL------------------CGIIPSSS----------SNSQFNV 493

  Fly   305 ALETETPSNPEDP------EQPMPLEFFSSASTGALEL------------------------EGS 339
            .:.|.:.|:|...      |..:....:|||.:....:                        |.|
Yeast   494 NVSTPSSSSPPSTSLIALLESSISRSDYSSAMSVLSNMKQLICETNFYRRGGKNPRDDMDGQEDS 558

  Fly   340 ASQDISLTNSELLEEESDNEQPLVL 364
            .::|.::..||.....|.|.:|::|
Yeast   559 FNKDTNVVKSENAGYPSVNSRPIIL 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 13/68 (19%)
bZIP_Jun 214..274 CDD:269844 25/75 (33%)
coiled coil 215..266 CDD:269844 24/66 (36%)
SKO1NP_014232.1 Aft1_HRA <196..>228 CDD:371723 9/32 (28%)
bZIP_ATF2 431..482 CDD:269835 23/68 (34%)
coiled coil 432..482 CDD:269835 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I3218
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.