DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and GBF1

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_195391.1 Gene:GBF1 / 829826 AraportID:AT4G36730 Length:315 Species:Arabidopsis thaliana


Alignment Length:335 Identity:66/335 - (19%)
Similarity:107/335 - (31%) Gaps:133/335 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQ---TP----- 108
            ||||                   |.|..:.||        :|........:::|.   ||     
plant    43 TPNP-------------------FFPSPVGSP--------SPHPYMWGAQHHMMPPYGTPVPYPA 80

  Fly   109 --QPGKVF-------PTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAA- 163
              .||.|:       |..:||                    ||.:......|...|..|:...| 
plant    81 MYPPGAVYAHPSMPMPPNSGP--------------------TNKEPAKDQASGKKSKGNSKKKAE 125

  Fly   164 ----AMTAVNNGISGGTFTYTNMTEGFSVIKDEPVNQ-----------------ASS-------- 199
                |::  .:|..|.:.:..::|.|.|...||..||                 |||        
plant   126 GGDKALS--GSGNDGASHSDESVTAGSSDENDENANQQEQGSIRKPSFGQMLADASSQSTTGEIQ 188

  Fly   200 ---------PTVN------------PIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDR 243
                     |..|            .:.::.:.::|.::::|.||.:|.:.|.||.....:|:.|
plant   189 GSVPMKPVAPGTNLNIGMDLWSSQAGVPVKDERELKRQKRKQSNRESARRSRLRKQAECEQLQQR 253

  Fly   244 VKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQXHLELSAGENDEEDVALET 308
            |:.|..||..|...::.|.....:||.:             |::.|..|:...|   .|.||...
plant   254 VESLSNENQSLRDELQRLSSECDKLKSE-------------NNSIQDELQRVLG---AEAVANLE 302

  Fly   309 ETPSNPEDPE 318
            :..:..:|.|
plant   303 QNAAGSKDGE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 15/84 (18%)
bZIP_Jun 214..274 CDD:269844 18/59 (31%)
coiled coil 215..266 CDD:269844 15/50 (30%)
GBF1NP_195391.1 MFMR 1..94 CDD:400228 15/77 (19%)
BRLZ 220..284 CDD:197664 19/76 (25%)
coiled coil 225..276 CDD:269850 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.