DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and june

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001070211.1 Gene:june / 767776 ZFINID:ZDB-GENE-060929-812 Length:323 Species:Danio rerio


Alignment Length:246 Identity:86/246 - (34%)
Similarity:128/246 - (52%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DLSSKTVNTPDLEKILLSNN---LMQTPQPGKVFPTKAGP------VTVEQLDFGRGFEEALHNL 139
            |::...:::||||.:::.:|   :..:|.||    ..|.|      .|.||..|..||.:||.:|
Zfish    77 DINLLKLSSPDLEHLIIQSNQGLVTTSPAPG----GSANPFLYRNQATNEQEGFADGFVKALADL 137

  Fly   140 HTNSQ-------------------AFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYT----- 180
            |..:|                   ..|||:....:..::.|.:...|      |..:.:|     
Zfish   138 HKQNQLLAPPSPTPAPLQSSYQRSLMPSADMPIYTTLSSYTPSPYPA------GQLYPHTSAHAT 196

  Fly   181 ---------NMTEGFSVIKDEPVNQASS-PTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLE 235
                     :..:....:...|.:..|| |.::|||:|.||:||.|||:.|||:|||||||||||
Zfish   197 GLHPQSRGPDAPQTVPEVPHPPGDPCSSPPALSPIDLETQERIKAERKKLRNRIAASKCRKRKLE 261

  Fly   236 RISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNS 286
            |||:||::|||||.:|.||||....|::.||||||:||.|:.:||.:..:|
Zfish   262 RISRLEEKVKVLKTQNSDLASTAGILREQVAQLKQKVMNHVTSGCQISVSS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 21/68 (31%)
bZIP_Jun 214..274 CDD:269844 41/59 (69%)
coiled coil 215..266 CDD:269844 33/50 (66%)
juneNP_001070211.1 Jun 1..215 CDD:281890 29/147 (20%)
bZIP_Jun 240..300 CDD:269844 41/59 (69%)
coiled coil 241..292 CDD:269844 33/50 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583928
Domainoid 1 1.000 92 1.000 Domainoid score I7564
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4287
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1090460at2759
OrthoFinder 1 1.000 - - FOG0001331
OrthoInspector 1 1.000 - - otm25062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11462
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1044
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.