DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and junbb

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_997915.1 Gene:junbb / 336038 ZFINID:ZDB-GENE-040426-2666 Length:310 Species:Danio rerio


Alignment Length:284 Identity:86/284 - (30%)
Similarity:135/284 - (47%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QSPNLNTSTPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILL--SNNLMQ 106
            |.|.:|.:...|..|....||...|             |.|:.|..:.:|:||::::  .|.::.
Zfish    32 QKPGMNLNVTEPPYRSLKSDLYQAS-------------SADVGSLKLASPELERLIIQTGNGVLT 83

  Fly   107 TPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNG 171
            ||.||:....:.  :|.||..|..||.:||..||..:| .|..|.:..:....|.:...:...:.
Zfish    84 TPTPGQYLYGRG--ITDEQEGFAEGFVKALDELHKMNQ-MPPPNVSIGAGGVTTCSTTASVFGSS 145

  Fly   172 ISGGTFTYTNMT---------------------------------------EGFSVIKDEPV--- 194
            :......||.:.                                       :.|..:|:||.   
Zfish   146 LQSEPPIYTTLNAYCPAPSHPSTTISYLPSHIQQSQHPETAHAFQHPGVLPQRFLPLKEEPQTVP 210

  Fly   195 ---NQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLAS 256
               :...||.::||||::||:||.||||.||.:||:|||:||||||::||::|||||.:|..|::
Zfish   211 DMHSSDGSPPMSPIDMDSQERIKAERKRLRNLLAATKCRRRKLERIARLEEKVKVLKSDNAGLSN 275

  Fly   257 IVKNLKDHVAQLKQQVMEHIAAGC 280
            ....|::.||||||:|:.|:.:||
Zfish   276 TASVLREQVAQLKQKVLRHMNSGC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 21/69 (30%)
bZIP_Jun 214..274 CDD:269844 35/59 (59%)
coiled coil 215..266 CDD:269844 27/50 (54%)
junbbNP_997915.1 Jun 5..220 CDD:281890 40/203 (20%)
bZIP_Jun 233..293 CDD:269844 35/59 (59%)
coiled coil 234..285 CDD:269844 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583932
Domainoid 1 1.000 92 1.000 Domainoid score I7564
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4287
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1090460at2759
OrthoFinder 1 1.000 - - FOG0001331
OrthoInspector 1 1.000 - - otm25062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11462
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1044
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.