DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and atf31

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_593039.1 Gene:atf31 / 2541860 PomBaseID:SPAC22F3.02 Length:209 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:28/99 - (28%)
Similarity:49/99 - (49%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 VNQAS--SPTVNPIDMEAQEKIKLERKRQ-----RNRVAASKCRKRKLERISKLEDRVKVLKGEN 251
            :::||  ||:....|...:...||...:|     |||.||.|||.:|.:.:..|:|:|.....||
pombe    96 ISEASHNSPSRELDDSGDENTSKLTGTKQSMLKARNRQAAQKCRIKKKKYLQTLQDQVNYYTSEN 160

  Fly   252 VDLASIVKNLKDHVAQLKQQVMEH----IAAGCT 281
            .:|.....:|::.:.:|:..|..|    ::..|:
pombe   161 KELLQSANDLREEIIKLRTLVFAHRDCPVSKACS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890
bZIP_Jun 214..274 CDD:269844 21/64 (33%)
coiled coil 215..266 CDD:269844 18/55 (33%)
atf31NP_593039.1 bZIP_ATF2 123..183 CDD:269835 19/59 (32%)
coiled coil 123..183 CDD:269835 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106880
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.