DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and atf21

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_595707.1 Gene:atf21 / 2540363 PomBaseID:SPBC2F12.09c Length:355 Species:Schizosaccharomyces pombe


Alignment Length:283 Identity:62/283 - (21%)
Similarity:95/283 - (33%) Gaps:95/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAAANLSIQNAGSSGATAIQIIPKTEPVGEEGP--MSLDFQSPNLNTSTPNPNKRPGSLDL--NS 66
            |..:.|:..|.||.     |::......|...|  :..:....|:|.:.....|   .|||  ||
pombe   140 SEGSTLNHYNNGSH-----QVLHPQFQNGTNAPYVVQSNLMQNNVNLTGAEQEK---GLDLYKNS 196

  Fly    67 KSAKNKRIFAPLVINSPDLSSKTVNTPDLEKI----LLSNNLMQTPQPGKVFPTKAGPVTVEQLD 127
            .:|.|..||.                 :||.:    .|::|..|:..|...:             
pombe   197 ATANNDEIFY-----------------NLESLRREGYLNSNKKQSQSPNGDY------------- 231

  Fly   128 FGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDE 192
                                  ||:..|.:|.|.|::.   ..|..|....:|            
pombe   232 ----------------------NSSDESCSNKTVASSQ---RRGTPGSNNVHT------------ 259

  Fly   193 PVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASI 257
                 :|....| ||      |..|..:|||:||||||::|......||....:...::..|..:
pombe   260 -----ASNNETP-DM------KRRRFLERNRIAASKCRQKKKLWTQNLEKTAHIACEQSKALRIL 312

  Fly   258 VKNLKDHVAQLKQQVMEHIAAGC 280
            |..|::.|..||.|::.|....|
pombe   313 VSQLREEVICLKNQLLAHQDCNC 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 6/71 (8%)
bZIP_Jun 214..274 CDD:269844 21/59 (36%)
coiled coil 215..266 CDD:269844 16/50 (32%)
atf21NP_595707.1 bZIP_ATF2 269..329 CDD:269835 21/59 (36%)
coiled coil 269..329 CDD:269835 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.