DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and atf1

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001342974.1 Gene:atf1 / 2540329 PomBaseID:SPBC29B5.01 Length:566 Species:Schizosaccharomyces pombe


Alignment Length:308 Identity:71/308 - (23%)
Similarity:128/308 - (41%) Gaps:74/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTPNPNKRPGSLDLN 65
            ::.|:|:      :|..::..||..::.:|:.  :..|.|:   .|:...:| ||....|:::..
pombe   291 LQQPISS------ENDQAASTTANNLLKQTQQ--QTFPDSI---RPSFTQNT-NPQAVTGTMNPQ 343

  Fly    66 SKSAKNKRIF---APLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGPVTVEQLD 127
            :...:.:.::   :......|.:...|||..|     .|..|.||                  .|
pombe   344 ASRTQQQPMYFMGSQQFNGMPSVYGDTVNPAD-----PSLTLRQT------------------TD 385

  Fly   128 F-GRGFEEALHNL--HTNSQAFPSANS---------------AANSAANNTTAAAMTAVNNGISG 174
            | |:..|....||  .|::...|:|||               ..:|.|||.::.. :::|...|.
pombe   386 FSGQNAENGSTNLPQKTSNSDMPTANSMPVKLENGTDYSTSQEPSSNANNQSSPT-SSINGKASS 449

  Fly   175 GTFTYTNMTEGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISK 239
            .:...|:.::|.|          ...:.|..| |.:.|..|||.||    ||.|||:||.:.:|.
pombe   450 ESANGTSYSKGSS----------RRNSKNETD-EEKRKSFLERNRQ----AALKCRQRKKQWLSN 499

  Fly   240 LEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNST 287
            |:.:|:....||..|::.|..|::.:..||..::.|  ..|.|..:::
pombe   500 LQAKVEFYGNENEILSAQVSALREEIVSLKTLLIAH--KDCPVAKSNS 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 16/70 (23%)
bZIP_Jun 214..274 CDD:269844 22/59 (37%)
coiled coil 215..266 CDD:269844 20/50 (40%)
atf1NP_001342974.1 Aft1_HRA 152..234 CDD:314623
Macoilin <280..>532 CDD:313022 68/291 (23%)
bZIP_ATF2 474..534 CDD:269835 23/63 (37%)
coiled coil 474..534 CDD:269835 23/63 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.