DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and Jund

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_620230.1 Gene:Jund / 24518 RGDID:2945 Length:341 Species:Rattus norvegicus


Alignment Length:348 Identity:110/348 - (31%)
Similarity:161/348 - (46%) Gaps:78/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKTP------VSAAANLSIQNAGSSGA----------TAIQIIPKTEPVGEEGPMSLDFQSPNLN 49
            |:||      :|..|..:...||::||          .|....|.|..:.::..::|........
  Rat     1 METPFYGEEALSGLAAGASSVAGAAGAPGGGGFAPPGRAFPGAPPTSSMLKKDALTLSLAEQGAA 65

  Fly    50 TSTPNPNKRPGSLDLNSKSAKNKRIFAP-LVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGK- 112
            ...|.....|.:|..:.         || .::.||||....:.:|:||::::.:|.:.|..|.. 
  Rat    66 GLKPGSATAPSALRPDG---------APDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTST 121

  Fly   113 --VFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGIS-- 173
              ::|..|..   |:.:|..||.:||.:||..||.  .|.:||.|.|....|.|..|...|.:  
  Rat   122 QFLYPKVAAS---EEQEFAEGFVKALEDLHKQSQL--GAATAATSGAPAPPAPADLAATPGATET 181

  Fly   174 ----------------GGTFTYTNMTE--------------------GFSVIKDEP------VNQ 196
                            ||..|.....|                    ..:.:||||      .:.
  Rat   182 PVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALGPPPPPHPPRLAALKDEPQTVPDVPSF 246

  Fly   197 ASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNL 261
            ..||.::||||:.||:||.||||.|||:||||||||||||||:||::||.||.:|.:|||....|
  Rat   247 GDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLL 311

  Fly   262 KDHVAQLKQQVMEHIAAGCTVPP 284
            ::.||||||:|:.|:.:||.:.|
  Rat   312 REQVAQLKQKVLSHVNSGCQLLP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 22/71 (31%)
bZIP_Jun 214..274 CDD:269844 40/59 (68%)
coiled coil 215..266 CDD:269844 32/50 (64%)
JundNP_620230.1 Jun 1..251 CDD:397861 58/263 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..49 7/27 (26%)
Menin-binding motif (MBM). /evidence=ECO:0000250|UniProtKB:P17535 35..47 2/11 (18%)
MAP kinase docking motif, essential for its phosphorylation. /evidence=ECO:0000250|UniProtKB:P17535 51..60 1/8 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..85 4/28 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..176 8/20 (40%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 262..289 22/26 (85%)
bZIP_Jun 264..323 CDD:269844 39/58 (67%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 290..318 13/27 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343681
Domainoid 1 1.000 89 1.000 Domainoid score I7653
eggNOG 1 0.900 - - E1_KOG0837
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4456
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1090460at2759
OrthoFinder 1 1.000 - - FOG0001331
OrthoInspector 1 1.000 - - otm45162
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11462
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1044
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.