DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and F19B2.6

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_507885.2 Gene:F19B2.6 / 184664 WormBaseID:WBGene00008945 Length:807 Species:Caenorhabditis elegans


Alignment Length:406 Identity:75/406 - (18%)
Similarity:126/406 - (31%) Gaps:143/406 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTPNPNKRPGSLD-----LNSKS----AKN 71
            ||..|........:..|.|...|.:.....||   ..||||...|..|     ||..:    .:|
 Worm   399 AGMKGCCVKDQYHEPAPSGYHPPQAQSNCYPN---HPPNPNMNAGDQDRQHVQLNFYTDPGFQQN 460

  Fly    72 KRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEAL 136
            ..:        |....:...|..::.....||     ||..:|.:..|..||.....| .::|.:
 Worm   461 SHV--------PYEMQQGFQTTGMQGSYQQNN-----QPELLFDSNNGNQTVNNAPNG-NYQEPV 511

  Fly   137 H---------NLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDE 192
            :         |.:.|...|||                                          |:
 Worm   512 YPLLQEGPTWNNNDNHDYFPS------------------------------------------DD 534

  Fly   193 PVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRK---LERISKLEDRVK-----VLKG 249
            .::|.|.   .|:.:|:   |:.:.||.:|::.|.|..::|   |:...|..:.||     :|..
 Worm   535 SMSQTSQ---EPVSVES---IRKKTKRAKNKLEARKSLQKKKDDLKASRKSWEEVKINHNNILSS 593

  Fly   250 ENVDLASIVKNLKDHVAQL------KQQVMEHIAAGCTVPPNSTDQXHLELSAGENDEEDV---- 304
            .|    |..:|:|....|:      .|||:     |......|.|: ....:..|||::::    
 Worm   594 NN----SNEENIKTAFDQVLYPCFTNQQVI-----GTFNIIRSYDEVQEGFAQFENDKQNIISKV 649

  Fly   305 -------------------------ALETETPSNPEDPEQPMPLEFFSSASTGALELEGSASQDI 344
                                     ..||:..:..||.::        :...|..:|.|......
 Worm   650 DYLMKTDRNLKKLRMAKEVSEKQWEQFETDKKNRKEDDKK--------NKINGGNKLNGKTKIVS 706

  Fly   345 SLTNSELLEEESDNEQ 360
            |:|.:.......|.::
 Worm   707 SITIATRCSRSKDKKE 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890 14/76 (18%)
bZIP_Jun 214..274 CDD:269844 19/73 (26%)
coiled coil 215..266 CDD:269844 15/58 (26%)
F19B2.6NP_507885.2 Med15 <37..>351 CDD:255446
235kDa-fam <546..>754 CDD:130673 37/197 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.