DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jra and batf2

DIOPT Version :9

Sequence 1:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001373344.1 Gene:batf2 / 100007087 ZFINID:ZDB-GENE-160728-52 Length:158 Species:Danio rerio


Alignment Length:144 Identity:35/144 - (24%)
Similarity:58/144 - (40%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 EGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLK 248
            |.|.  :..|.:|:        |.::.::.....:|::||.||.|.||::.|:...|.:.::.|:
Zfish     7 ENFD--RGSPFSQS--------DSQSPQEWNTSDRREKNRDAARKSRKKQTEKADLLHEELQTLE 61

  Fly   249 GENVDLASIVKNLKDHVAQLK--QQVMEHIAAGCTV-----PPNSTDQXHLELSAGENDEEDVAL 306
            ..|   |:.||.:.|...||:  :..:|.....||.     ||.|...               |.
Zfish    62 QAN---AAFVKEIADLKKQLQIYKTALEQHEPHCTKLGSFGPPASVSG---------------AP 108

  Fly   307 ETETPSNPEDPEQP 320
            .|.|||..:....|
Zfish   109 STATPSTSDYVSSP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JraNP_001260844.1 Jun <76..>144 CDD:281890
bZIP_Jun 214..274 CDD:269844 18/61 (30%)
coiled coil 215..266 CDD:269844 16/50 (32%)
batf2NP_001373344.1 bZIP_BATF 25..82 CDD:269849 18/59 (31%)
coiled coil 28..79 CDD:269849 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.