DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf167 and DMA2

DIOPT Version :9

Sequence 1:NP_001008362.1 Gene:Rnf167 / 360554 RGDID:1305972 Length:349 Species:Rattus norvegicus
Sequence 2:NP_014283.3 Gene:DMA2 / 855607 SGDID:S000005060 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:47/148 - (31%)
Similarity:70/148 - (47%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat   183 LLVLAM----GTVLIVRCIQHRKRLQR------NRLTKEQLKQIPTHDYQK---GDEYDVCAICL 234
            :|.|.|    ||..|.||::.|..|.|      |...||.|:::  .:.||   |.|.:.|:|||
Yeast   375 ILQLGMDFRGGTEEIYRCVRMRIELNRSWKLKANSFNKEALQRL--QNLQKLTTGIEEEDCSICL 437

  Rat   235 DEYEDGDKLRILPCAHAYHSRCVD--PWLTQTRKTCPICKQPVHRGPGDEEQEEETQGQEEEGDE 297
            .:.:....:.|.||||::|.|||.  ..|:..:..||.|     |...|.|...|:..:|:|.|.
Yeast   438 CKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNC-----RSSCDLEASFESSDEEDESDV 497

  Rat   298 GEPRDQPASEWTPLLGSS 315
            ....||...:.:.|:.:|
Yeast   498 ESEGDQLVDQLSVLMETS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf167NP_001008362.1 PA_C_RZF_like 20..170 CDD:239038
RING-H2_RNF167 228..273 CDD:319711 17/46 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..349 12/45 (27%)
DMA2NP_014283.3 FHA 228..417 CDD:224630 15/41 (37%)
RING-H2_Dmap_like 431..477 CDD:319372 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.