DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf167 and HRD1

DIOPT Version :9

Sequence 1:NP_001008362.1 Gene:Rnf167 / 360554 RGDID:1305972 Length:349 Species:Rattus norvegicus
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:60/244 - (24%)
Similarity:92/244 - (37%) Gaps:62/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat   142 ERSAEYLRALFVYEKGARV------------LLVPDNSFPLGYYLIPFTGIVGLLVLAMGTVLIV 194
            :|....|...|:|||...|            :|:|   |.:...|:... :..:|.|......:.
Yeast   258 DRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIP---FRMPMMLLKDV-VWDILALYQSGTSLW 318

  Rat   195 RCIQHRKRLQRN--RLTKEQLKQIPTHDYQKGDEYDVCAICLDEY----------EDGDKLRILP 247
            :..::.|:|...  .:|.|||:.....|       ::|.||:||.          ....|.:.||
Yeast   319 KIWRNNKQLDDTLVTVTVEQLQNSANDD-------NICIICMDELIHSPNQQTWKNKNKKPKRLP 376

  Rat   248 CAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEEQEEETQGQE------EEGDEGEPRDQP-- 304
            |.|..|..|:..|:.:: :|||||:.||....|:..|...|...:      .....|...||.  
Yeast   377 CGHILHLSCLKNWMERS-QTCPICRLPVFDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGF 440

  Rat   305 ASEWTPLLGSSPTLPTSFGSLAPAPLVFPGPSTD---------PSPSPS 344
            |:| ..||   ||..||     |...:.|..:.|         .:|||:
Yeast   441 ANE-VDLL---PTRTTS-----PDIRIVPTQNIDTLAMRTRSTSTPSPT 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf167NP_001008362.1 PA_C_RZF_like 20..170 CDD:239038 10/39 (26%)
RING-H2_RNF167 228..273 CDD:319711 18/54 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..349 23/91 (25%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.