DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf167 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001008362.1 Gene:Rnf167 / 360554 RGDID:1305972 Length:349 Species:Rattus norvegicus
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:229 Identity:55/229 - (24%)
Similarity:96/229 - (41%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat    86 LLRRFDCNFDLKVLNAQKAGYGAAVV---HNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEY 147
            |::|..|.:..|.|.||:.|:...:|   .:.:|..|..||...:..:.::.|||:|:...|...
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYNL 210

  Rat   148 LRA--LFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGTVLI--VRCIQHRKRLQRNRL 208
            |.:  |..|.:..::...|:.   ||....||     ||..:...:::  |:.:..||.::..|.
pombe   211 LWSDLLHSYRQPLKLYAKPEE---LGDMFWPF-----LLCFSPSIIMLITVQALAIRKFIRTYRT 267

  Rat   209 ---TKEQLKQIPTHD------YQKGDEYD-----------------------VCAICLDEYEDGD 241
               |:..::.:|:..      |.:.:|.:                       .|.|||:.:..||
pombe   268 KSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESFTKGD 332

  Rat   242 KLRILPCAHAYHSRCVDPWLTQTRKTCPICKQPV 275
            |:..|||.|.:|..|:..|:...|..||.|...|
pombe   333 KVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf167NP_001008362.1 PA_C_RZF_like 20..170 CDD:239038 22/88 (25%)
RING-H2_RNF167 228..273 CDD:319711 18/67 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..349 2/5 (40%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 55/229 (24%)
Peptidases_S8_S53 <144..211 CDD:299169 18/64 (28%)
zf-RING_2 320..362 CDD:290367 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2079
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm64279
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.