DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and ARN1

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_011823.1 Gene:ARN1 / 856345 SGDID:S000001032 Length:627 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:43/233 - (18%)
Similarity:84/233 - (36%) Gaps:81/233 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 INAIIFYSTFI-----------------FETAGSTLEPRISTI--IVGIVQAIATIISILVIEKV 303
            :.||:..|.||                 :.|:..:....:|||  |..:|.|.:.||...:.:..
Yeast    73 LQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVF 137

  Fly   304 GRKILLLVSACMMGISTLIM------------ALYFGMLMKSGVGWLALIAVCVFIIGFSLGFGP 356
            ||..|.:.:..:..:.|:|.            |:::      ..|::.:|.:.:.|:.   .|..
Yeast   138 GRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFY------NAGYVGVILILLIILS---DFSS 193

  Fly   357 VPWLMMAEL-----FAEDVKALAGSIAGTTNWCFAFIVTLLFPVLN---DIIGATACFAIFFGFA 413
            :.|.::.:.     |..:. .:||:|....|           ||:|   |:             .
Yeast   194 LKWRLLYQFVPTWPFIINT-WIAGNITSRAN-----------PVVNWSWDV-------------G 233

  Fly   414 VAAFVFILFLIP--------ETKGKTLNEIQAKMGEKA 443
            :.||:|.|..:|        :.:.:...|..|..|:|:
Yeast   234 MWAFIFPLSCVPIVLCMLHMQWRARKTPEWHALKGQKS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 40/224 (18%)
MFS 47..424 CDD:119392 38/204 (19%)
ARN1NP_011823.1 MFS_ARN_like 74..586 CDD:340880 43/232 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.