DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and ARN2

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_011816.2 Gene:ARN2 / 856338 SGDID:S000001039 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:61/283 - (21%)
Similarity:116/283 - (40%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 MIFMPESPIFLAQKGKAEKAEKSLKFLR--GKDADVSGELKEMSAEGQKEKASV---GKILCRRI 238
            ||.:||..  .:.:.|.:..||:...|.  .|..|.|....||..:.:..|:.:   .:::.::.
Yeast     1 MIEVPEDN--RSSQTKRKNTEKNCNELMVDEKMDDDSSPRDEMKDKLKGTKSLIIRKSELMAKKY 63

  Fly   239 ---TLKGLFL-SIGLMLFQQMTGINAII--FYSTFIFETAGSTLEPRIST--IIVGIVQAIATII 295
               .||.:|| |..:..|..  |:::.|  .|.|:...:..:  ...|||  :||.::.|::.:|
Yeast    64 DTWQLKAIFLFSAFICTFAY--GLDSSIRGTYMTYAMNSYSA--HSLISTVSVIVLMISAVSQVI 124

  Fly   296 SILVIEKVGRKILLLVSACMMGISTLIMALYFGMLMKSGVG----WLALIAVCVFIIGFSLGFGP 356
            ...:.:..||..|.|||..:..:.|:|.:..:. :.:...|    ::.|:.|.:.::........
Yeast   125 FGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYD-VQRYAAGAVFYYVGLVGVMLQVVLMLSDNSS 188

  Fly   357 VPWLMMAELFAEDVKALAGSIAGTTNWCFAFIVTLLFPVLNDIIGATACFAIFFGFAVAAFVFIL 421
            :.|    .||...:.:....|   |.|....:|....|:.|          ..:..|:.||:|.|
Yeast   189 LKW----RLFYTLIPSWPSII---TTWVSGSVVEAANPLEN----------WSWNIAMWAFIFPL 236

  Fly   422 FLIP------ETKGKTLNEIQAK 438
            ..||      ..:.|..|:::.|
Yeast   237 CCIPLILCMLHMRWKVRNDVEWK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 60/279 (22%)
MFS 47..424 CDD:119392 56/261 (21%)
ARN2NP_011816.2 MFS_ARN_like 69..581 CDD:340880 46/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.