DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and CG42825

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_729590.1 Gene:CG42825 / 39179 FlyBaseID:FBgn0262007 Length:518 Species:Drosophila melanogaster


Alignment Length:497 Identity:99/497 - (19%)
Similarity:175/497 - (35%) Gaps:134/497 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GFIGALGAFCLGAVIGWSGPVENEVKNSNAYNFTPRQTEW---GLVGSLMTLGAAFSCIPVGVLI 71
            |.|...|...:...||:.||:..:....|       ...|   .::|:|:|:          .|.
  Fly    85 GLIFISGGMNIAWAIGFQGPIYYQTTKHN-------YIAWFIGAIIGALVTM----------ALT 132

  Fly    72 GKIGRKTTMLILLPPFFIGWLLILLA-SHIAMLLLGRFVVGFCGGAFCVTCPMYVTEIAQVQYRG 135
            .|:.:|..:........:|.|:|... ::.|......::.|...|.........|.||:....||
  Fly   133 NKVAKKYILQFSSVLVTVGGLVIACTHNNGAGTTAACYLDGIANGLVFAPFMALVGEISVPYLRG 197

  Fly   136 TMGCFFQLL-----IVFGILYAFVVGGFVKTFYF--------NIACAILPVIFFVLMIFMP---- 183
            ......:.|     |:..|||   |..:..:.|.        |:. .:|..|:.||.:.|.    
  Fly   198 KASATLEQLCFGTGILLQILY---VSNWTYSSYMTYNDFTSENMK-GVLSTIYGVLALIMGSFFT 258

  Fly   184 -ESPIFLAQKGKAEKAEKSLKFLRGKDADVSGELKEMSAEGQKEKASVGKILCRRITLKGLFLSI 247
             |||:.:....:.:.|..:|:.|: |.|.::.|..|:.|| .|...:..|.:.     |...:|.
  Fly   259 IESPVLMLANNEEQAAIDALRRLQ-KPAVLTEETYELLAE-HKRYLAYNKNMS-----KSESISK 316

  Fly   248 GLMLFQQMTGINAI--IFYSTFIFETAGSTLEPRISTIIVGIV------QAIATIISILVIEKVG 304
            .|..|.::..:.|:  :..|:|:           |.|.:|.|:      .|.:..|.:.....:|
  Fly   317 ALPTFMRLAYLRALNAMSISSFV-----------IITYVVAILVSNDLRNASSWYIGLAFCRWLG 370

  Fly   305 RKILLLVSACMMGISTLIMALYFGMLMKSGVG-----------WLALIAVCVFIIGFSLGFGPVP 358
            .   |:.|.||..:.....|: ||:|:..|:.           :::.:.|.:.|..|..|     
  Fly   371 S---LIPSFCMESLGRKKPAV-FGLLVSCGLSFAVGSQYNVYTYMSQVTVLIMIFEFFAG----- 426

  Fly   359 WLMMAELFAEDVKALAGSIAGTTNWCFAFIVTLLFP--VLNDIIGATACFAIF---------FGF 412
                              :|.::|..:   :|..:|  |....||.|....||         |.|
  Fly   427 ------------------MAFSSNSAY---LTEAYPMGVKQHFIGLTFITEIFVFLIINVCDFNF 470

  Fly   413 A-------------VAAFVFILFLIPETKGKTLNEIQAKMGE 441
            .             :|..:..:..:|||:..||...|.:..:
  Fly   471 GQGYNYFYIMGAMYLAGVILGVLTLPETRRMTLQGAQEQFNK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 98/490 (20%)
MFS 47..424 CDD:119392 85/441 (19%)
CG42825NP_729590.1 MFS 116..490 CDD:119392 85/435 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444317
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.