DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and CG14160

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_648380.2 Gene:CG14160 / 39177 FlyBaseID:FBgn0036066 Length:483 Species:Drosophila melanogaster


Alignment Length:504 Identity:94/504 - (18%)
Similarity:178/504 - (35%) Gaps:120/504 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTATQFIVGFIGALGAFCLGAVIGWS---GPVENEVKNSNAYNFTPRQTEWGLVGSLMTLGAAF 62
            |.:|:...||        | |..:.||   .|....:.|.|.:|.   ...|       .:|||.
  Fly    29 MASASIVFVG--------C-GMRLAWSIFDTPAGKFLNNHNTHNL---MMSW-------FIGAAV 74

  Fly    63 SCIPVGVLIGKIGRK---TTMLILLPPFFIGWLLILLASHIAMLLLGRFVVGFCGGAFCVTCPMY 124
            ..:...:.:.::.:.   |:...|:  ...|.|.::|..|..........||...|...:...:.
  Fly    75 GALLAALFVQRVTKNVAYTSSGFLM--IIAGILNVVLPQHFLAACYSSVSVGAAYGLTQIQALVT 137

  Fly   125 VTEIAQVQYRGTMGCFFQLLIVFGI---------------------------LYAFVVGGFVKTF 162
            .:|:|....||.:....::.:..|:                           |:..|:.|     
  Fly   138 GSEVAHKSIRGMLLSCEKIFLWLGVCMQVFYTRVWHNLRPLDTQGYEMHIDQLHGMVLAG----- 197

  Fly   163 YFNIACAILPVIFFVLMIFMPESPIFLAQKGKAEKAEKSLKFLRGKDADVSGELK---------- 217
             ..:...||.:...:      |||:.|..:.:.....::||.|.|:.......|:          
  Fly   198 -LGLGAVILALAHRL------ESPLLLLHQERDMAVGETLKALHGQSTTELVRLREDCRQLHSAR 255

  Fly   218 --EMSAEGQKEKASVGKILCRRITLKGLFLSIGLMLFQQMTGINAIIFYSTFIFETAGSTLEPRI 280
              |...|..:|..:..::..|||.   .|..:  :|.:....:...:.|:......:...||..:
  Fly   256 DWERFVEEPEESVADWRVWARRIL---PFFKV--LLLRCFATLAVSLSYNRAFVVVSWHGLECDM 315

  Fly   281 STII-VGIVQAIATIISILVIEKVGRKILLLVSACMMGISTLIMALYFGML--MKSGVGWLALIA 342
            :.:. :.....|.:::...|::..||:.:..:|..:.|:..:::...|..|  :|.....:.|:.
  Fly   316 NCMYWLAFAGLIGSVLGAFVVDWQGRRKVCSLSLFLAGVVIVMVGGVFDHLESVKRSFYDINLLV 380

  Fly   343 VCVFIIGFSL---GFGPVPWLM-MAELF--AEDVKALAGSI-------AGTTNWCFAFIVTLLFP 394
            :.:.::.|.:   |...||.|: .||.|  |...:.|||.:       .|.....|...:|:   
  Fly   381 IALLMLLFEVIVAGGVAVPALVYTAEAFSIAHKARCLAGILIVEQLLQLGLLLATFEHYITV--- 442

  Fly   395 VLNDIIGATACFAIFFGFAVAAFVFILFL-----IPETKGKTLNEIQAK 438
                        ::|| |.:..|.||:.|     :|||:..||.|...|
  Fly   443 ------------SVFF-FTIGVFSFIVGLTVFMFMPETRQLTLYECLLK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 91/492 (18%)
MFS 47..424 CDD:119392 75/439 (17%)
CG14160NP_648380.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.