DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and Glut1

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster


Alignment Length:461 Identity:134/461 - (29%)
Similarity:226/461 - (49%) Gaps:44/461 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FIGALGAFCLGAVIGWSGPVENEVKNSNAYNFTPRQTE----------WGLVGSLMTLGAAFSCI 65
            |...||....|...|.....|..::|.....:..|..|          :.:..|:..:|......
  Fly    18 FSAVLGMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAIGGMLGGF 82

  Fly    66 PVGVLIGKIGRKTTMLI-----LLPPFFIGWLLILLASH-IAMLLLGRFVVGFCGGAFCVTCPMY 124
            ..|.:..:.|||..:|:     :.....:|:..:   || ..||.||||::|...|......|||
  Fly    83 SGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKV---SHSYEMLFLGRFIIGVNCGLNTSLVPMY 144

  Fly   125 VTEIAQVQYRGTMGCFFQLLIVFGILYAFVVG-----GFVKTFYFNIACAILPVIF-FVLMIFMP 183
            ::|||.:..||.:|...||.:..|:|.:.|:|     |..:.:...:..||.|.|. .:|:...|
  Fly   145 ISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCP 209

  Fly   184 ESPIF-LAQKGKAEKAEKSLKFLRGKDADVSGELKEMSAEGQKEKA----SVGKILCRRITLKGL 243
            |||.: |..|...|:|.|:|:.||. ...|..:::||.||.:.:::    |..:::|.......|
  Fly   210 ESPRYLLITKQWEEEARKALRRLRA-SGSVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPL 273

  Fly   244 FLSIGLMLFQQMTGINAIIFYSTFIFETAGSTLE-PRISTIIVGIVQAIATIISILVIEKVGRKI 307
            .:.|.:.|.||.:||||:.:|||.:|.::|.|.| .:.:||.:|.:..:.|::||.::::.||:.
  Fly   274 IIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRT 338

  Fly   308 LLLVSACMMGISTLIMALYFGMLMKSGVGW---LALIAVCVFIIGFSLGFGPVPWLMMAELFAED 369
            |.|.....|.|.::.:.:.|  |:|..:.|   |:::|...|::.|::|.|.:||::.||||::.
  Fly   339 LHLYGLGGMFIFSIFITISF--LIKEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQG 401

  Fly   370 VKALAGSIAGTTNWCFAFIVTLLFPVLNDIIGATACFAIFFGFAVAAFVFILFL---IPETKGKT 431
            .:..|.:||...||...|:|.:.||.:...:....    |..|:|...:|.:|.   :||||.||
  Fly   402 PRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYT----FLPFSVFLAIFWIFTYKKVPETKNKT 462

  Fly   432 LNEIQA 437
            ..||.|
  Fly   463 FEEILA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 132/458 (29%)
MFS 47..424 CDD:119392 117/410 (29%)
Glut1NP_612073.2 MFS 17..452 CDD:119392 125/443 (28%)
Sugar_tr 18..470 CDD:278511 134/461 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13833
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
43.810

Return to query results.
Submit another query.