DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and K09C4.2

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:91 Identity:25/91 - (27%)
Similarity:40/91 - (43%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 GFGPVPWLMMAELFAEDVKALAGSIAGTTNWCFAFIVTLLFPVLNDIIGATACFAIFF-GFAVAA 416
            |...:..|.:.|||....:.:.|......:......|..|||::|.|..     .||| .|.:..
 Worm    13 GANAIRLLFVTELFPPSARTVVGQAMLFGSMAVGMPVVSLFPIINSIFS-----PIFFVPFVIVQ 72

  Fly   417 FVFILFL---IPETKGKTLNEIQAKM 439
            .||.::|   :|||:|:.:.:|...|
 Worm    73 TVFGIYLYRYMPETRGRAVYDIIESM 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 23/86 (27%)
MFS 47..424 CDD:119392 19/74 (26%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.