DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and srx-128

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_506426.3 Gene:srx-128 / 186283 WormBaseID:WBGene00006019 Length:339 Species:Caenorhabditis elegans


Alignment Length:183 Identity:40/183 - (21%)
Similarity:72/183 - (39%) Gaps:60/183 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LFLSIGLMLFQQMTGINAIIF---YSTFI-FETAGSTLEPRISTIIVGIVQAIATIISILVIE-K 302
            ||.:|.:.....::..:.:||   ||.|: |:|:              ::.:|..|..:|... :
 Worm    17 LFRTIRMRQISIVSSPSELIFAKKYSFFLSFQTS--------------LLGSICNIYLLLKFSAR 67

  Fly   303 VGR-----KILLLVSACMMGISTLIMALYFGMLMKSGVGWLALIAVCVFIIGFSLGFGPVP-WLM 361
            .||     ||.|:.:     :..:|:.|.|       :.|:      |.:..||..:..|. || 
 Worm    68 DGRPNGFQKICLVKT-----VPNIIVCLSF-------LFWV------VPLTAFSYSYNEVNYWL- 113

  Fly   362 MAELFAEDVKALAGSIAGTTNWCFAFIVTLLFPVLNDIIGATACFAIFFGFAV 414
                     .:|.|.:|||  |.:     ||.|:|...:.....:.::|.|.:
 Worm   114 ---------NSLVGGVAGT--WAY-----LLTPILQVSMSCNRFYVLYFPFGI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 40/183 (22%)
MFS 47..424 CDD:119392 40/183 (22%)
srx-128NP_506426.3 7TM_GPCR_Srx 47..307 CDD:370981 32/153 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.