DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut4 and LOC101882789

DIOPT Version :9

Sequence 1:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_021331508.1 Gene:LOC101882789 / 101882789 -ID:- Length:181 Species:Danio rerio


Alignment Length:154 Identity:40/154 - (25%)
Similarity:72/154 - (46%) Gaps:24/154 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VGFCGGAFCVTCPMYVTEIAQVQYRGTMGCFFQLLIVFGILYAFVVGG---FVK--TFYFNIACA 169
            :..|.|...:|.|:|:.|.:....||.:.....|.|..|...|.|:.|   ::|  .:.:.:..:
Zfish    12 MSICAGIASMTVPVYIAETSPPHLRGRLVTINTLFITAGQFTASVIDGAFSYMKHEGWRYMLGLS 76

  Fly   170 ILPVIF-FVLMIFMPESPIFLAQKGKAEKAEKSLKFLRGKDADVSGELKEMSAEGQKEKASVG-- 231
            ::|.:. |:..:|:||||.:|.|||..:||.:.|..:|| :.::..|...:.:..::|:...|  
Zfish    77 VIPALLQFLGFLFLPESPRWLIQKGLTQKARRVLSQIRG-NQNIDEEYDTIKSSIEEEEKDCGGG 140

  Fly   232 --KIL-------------CRRITL 240
              |:|             ||..||
Zfish   141 EKKVLHVFTHASSSKKHKCRLGTL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 40/154 (26%)
MFS 47..424 CDD:119392 40/154 (26%)
LOC101882789XP_021331508.1 Sugar_tr <14..>135 CDD:331684 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.