DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and TNFSF12

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_003800.1 Gene:TNFSF12 / 8742 HGNCID:11927 Length:249 Species:Homo sapiens


Alignment Length:227 Identity:57/227 - (25%)
Similarity:89/227 - (39%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 RKSRSIADVRNEEQNIQGNHTELQEKSSNEATSKES--PAPLHHRRRMHSRHRHLLVRKGESLLS 270
            |.|.|..:...||...:    |.|:.|.....::||  |||..:|          |||...|...
Human    47 RASLSAQEPAQEELVAE----EDQDPSELNPQTEESQDPAPFLNR----------LVRPRRSAPK 97

  Fly   271 ARSEDSRP--AAHFHLSSRRRHQGSM-GYHGDMYIGNDNERNSYQG-HFQTRDGVLTVTNTGLYY 331
            .|...:|.  |||:.:..|....|:. |..|.:....:...||... .:..:.|...||..||||
Human    98 GRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYY 162

  Fly   332 VYAQICYNNSHDQNGFIVF------QGDTPFLQCLN----TVPTNMPHKVHTCHTSGLIHLERNE 386
            :|.|:     |...|..|:      ......|:||.    |..:::..::..|..|||:.|....
Human   163 LYCQV-----HFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGS 222

  Fly   387 RIHLKDI---HNDRNAVLREGNNRSYFGIFKV 415
            .:.::.:   |      |:.....:|||:|:|
Human   223 SLRIRTLPWAH------LKAAPFLTYFGLFQV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 35/151 (23%)
TNFSF12NP_003800.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..85 10/33 (30%)
TNF 131..248 CDD:214557 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.