DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and TNFSF13

DIOPT Version :10

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_003799.1 Gene:TNFSF13 / 8741 HGNCID:11928 Length:250 Species:Homo sapiens


Alignment Length:207 Identity:42/207 - (20%)
Similarity:82/207 - (39%) Gaps:71/207 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 IADVRNEEQNIQGN-----------HTELQEKSS-------NEATSKESPAPLHHRRRMHSRHRH 259
            :..:|.|...:||.           ...|.|:||       |...|::..|.|..:::......|
Human    55 LQSLRREVSRLQGTGGPSQNGEGYPWQSLPEQSSDALEAWENGERSRKRRAVLTQKQKKQHSVLH 119

  Fly   260 LLVRKGESLLSARSEDS--------RPAAHFHLSSRRRHQG--SMGYHGDMYIGNDNERNSYQGH 314
            |:.      ::|.|:|.        :||.       ||.:|  :.||                  
Human   120 LVP------INATSKDDSDVTEVMWQPAL-------RRGRGLQAQGY------------------ 153

  Fly   315 FQTRDGVLTVTNTGLYYVYAQICYNNSHDQNGFIVF---QG--DTPFLQCLNTVPTNMPHKVHTC 374
                 || .:.:.|:|.:|:|:.:.:.....|.:|.   ||  :|.| :|:.::|::.....::|
Human   154 -----GV-RIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLF-RCIRSMPSHPDRAYNSC 211

  Fly   375 HTSGLIHLERNE 386
            :::|:.||.:.:
Human   212 YSAGVFHLHQGD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 25/116 (22%)
TNFSF13NP_003799.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108 3/18 (17%)
TNF 117..248 CDD:238108 30/145 (21%)

Return to query results.
Submit another query.