DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and eda

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001108537.1 Gene:eda / 798740 ZFINID:ZDB-GENE-050107-6 Length:359 Species:Danio rerio


Alignment Length:101 Identity:29/101 - (28%)
Similarity:54/101 - (53%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 TRDGVLTVTNTGLYYVYAQ--ICYNNSHDQNGFIVFQGDTPFLQCLNTVPTNMPHKVHTCHTSGL 379
            :|.|.|.|...|.|::|:|  :.|.|..|...:.|....||||:|..::.|.. .|.:||:|:|:
Zfish   253 SRSGELEVLLDGTYFIYSQVEVYYLNFTDIASYEVMVDKTPFLRCTRSIETGQ-RKFNTCYTAGV 316

  Fly   380 IHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
            ..|...:||.::.::.|.:  :...|:.::.|..::
Zfish   317 CLLRARQRISIRMVYEDTS--ISMSNHTTFLGSIRL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 29/97 (30%)
edaNP_001108537.1 TNF 214..346 CDD:294099 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11510
eggNOG 1 0.900 - - E1_28MSH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto41139
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.