DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and eda

DIOPT Version :10

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001108537.1 Gene:eda / 798740 ZFINID:ZDB-GENE-050107-6 Length:359 Species:Danio rerio


Alignment Length:101 Identity:29/101 - (28%)
Similarity:54/101 - (53%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 TRDGVLTVTNTGLYYVYAQ--ICYNNSHDQNGFIVFQGDTPFLQCLNTVPTNMPHKVHTCHTSGL 379
            :|.|.|.|...|.|::|:|  :.|.|..|...:.|....||||:|..::.|.. .|.:||:|:|:
Zfish   253 SRSGELEVLLDGTYFIYSQVEVYYLNFTDIASYEVMVDKTPFLRCTRSIETGQ-RKFNTCYTAGV 316

  Fly   380 IHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
            ..|...:||.::.::.|.:  :...|:.::.|..::
Zfish   317 CLLRARQRISIRMVYEDTS--ISMSNHTTFLGSIRL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 29/97 (30%)
edaNP_001108537.1 TNF 214..346 CDD:444713 28/95 (29%)

Return to query results.
Submit another query.