DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Tnfsf13

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_076006.2 Gene:Tnfsf13 / 69583 MGIID:1916833 Length:241 Species:Mus musculus


Alignment Length:224 Identity:45/224 - (20%)
Similarity:92/224 - (41%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 IADVRNEEQNIQ--GNHTELQEKSSNEATSKESPAPLH--------HRRRMHSRHRHLLVRKGES 267
            :..:|.|...:|  |..::.|.:...::..::||..|.        .|||.....:|   :|..|
Mouse    46 LQSLRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKH---KKKHS 107

  Fly   268 LLS------ARSEDSRPAAHFHLSSRRRHQGSMGYHGDMYIGNDNERNSYQGHFQTRDGVLTVTN 326
            :|.      ....||...........||.:|                      .:.:..::.|.:
Mouse   108 VLHLVPVNITSKADSDVTEVMWQPVLRRGRG----------------------LEAQGDIVRVWD 150

  Fly   327 TGLYYVYAQICYNNSHDQNGFIVF---QG--DTPFLQCLNTVPTNMPHKVHTCHTSGLIHLERNE 386
            ||:|.:|:|:.:::.....|.:|.   ||  :|.| :|:.::|::.....::|:::|:.||.:.:
Mouse   151 TGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLF-RCIRSMPSDPDRAYNSCYSAGVFHLHQGD 214

  Fly   387 RIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
            .|.:|...  .||.|....:.::.|..|:
Mouse   215 IITVKIPR--ANAKLSLSPHGTFLGFVKL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 27/139 (19%)
Tnfsf13NP_076006.2 TNF 108..239 CDD:238108 30/155 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008250
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15151
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.