DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Tnfsfm13

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001029269.1 Gene:Tnfsfm13 / 619441 MGIID:3845075 Length:410 Species:Mus musculus


Alignment Length:229 Identity:55/229 - (24%)
Similarity:97/229 - (42%) Gaps:54/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LQEKSSNEATSKESPAP--------LHHRRRMHSRHRHLLVRKG-----------ESLLSARSED 275
            |:|.|   ||:..||.|        |...||..||    |.|.|           :||.. :|.|
Mouse   193 LEEFS---ATAASSPGPQLRLCQTELQSLRREVSR----LQRSGGPSQKQGERPWQSLWE-QSPD 249

  Fly   276 SRPAAHFHLSSRRRH----QGSMGYHGDMYI---------GNDNERNSYQ-----GH-FQTRDGV 321
            ...|......||||.    |.....|..:::         .:|.....:|     |. .:.:..:
Mouse   250 VLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDI 314

  Fly   322 LTVTNTGLYYVYAQICYNNSHDQNGFIVF---QG--DTPFLQCLNTVPTNMPHKVHTCHTSGLIH 381
            :.|.:||:|.:|:|:.:::.....|.:|.   ||  :|.| :|:.::|::.....::|:::|:.|
Mouse   315 VRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLF-RCIRSMPSDPDRAYNSCYSAGVFH 378

  Fly   382 LERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
            |.:.:.|.:|...  .||.|....:.::.|..|:
Mouse   379 LHQGDIITVKIPR--ANAKLSLSPHGTFLGFVKL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 34/158 (22%)
Tnfsfm13NP_001029269.1 TNF 132..>217 CDD:294099 9/26 (35%)
TNF 277..408 CDD:238108 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.