DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and tnfsf12

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001070075.1 Gene:tnfsf12 / 567542 ZFINID:ZDB-GENE-060929-376 Length:236 Species:Danio rerio


Alignment Length:175 Identity:46/175 - (26%)
Similarity:79/175 - (45%) Gaps:27/175 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LLVRKGESLLSAR---------SEDSRPAAHFHLSSRRRHQGSMGYHGDMYIGNDNERN-SYQGH 314
            |::.|.|.|.|.|         ....:.|:||.::|....:  :|..|.:....:.:.| |...:
Zfish    69 LILEKRELLESQRFRRDVGGKKGNGRKVASHFEITSDSFQK--VGNEGVIKGWTEEQLNMSRAVN 131

  Fly   315 FQTRDGVLTVTNTGLYYVYAQICYNNSHDQNGFIVFQGDT---PFLQCL---NTVPTNMPHKVH- 372
            :.:..|...|..:|:|:||.|:.:|.:..|  ::..:...   |.|||:   .|.|.:..|:.| 
Zfish   132 YNSETGTFRVERSGVYFVYCQVHFNENQSQ--YVKLEVSIPKGPLLQCIEGYGTTPASGSHRFHF 194

  Fly   373 --TCHTSGLIHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
              .|..|||:.|  |:...||.:.....::...|  :.|||:|||
Zfish   195 LKPCQVSGLLRL--NKGTELKAVTGASFSLQTSG--KHYFGLFKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 37/144 (26%)
tnfsf12NP_001070075.1 DivIC 18..>84 CDD:299713 6/14 (43%)
TNF 118..235 CDD:294099 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.