DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egr and Tnfsf13b

DIOPT Version :9

Sequence 1:NP_724878.2 Gene:egr / 36054 FlyBaseID:FBgn0033483 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_006253542.1 Gene:Tnfsf13b / 498666 RGDID:1561519 Length:325 Species:Rattus norvegicus


Alignment Length:110 Identity:24/110 - (21%)
Similarity:56/110 - (50%) Gaps:14/110 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 QTRDGVLTVTNTGLYYVYAQICYNNSHDQNGFIVFQ------GD----TPFLQCLNTVPTNMPHK 370
            :.::..:.|..||.:::|:|:.|.:.....|.::.:      ||    ....:|:..:|..:|: 
  Rat   219 EEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKIHVFGDELSLVTLFRCIQNMPKTLPN- 282

  Fly   371 VHTCHTSGLIHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV 415
             ::|:::|:..||..:.|.|. |..:...:.|.|:: ::||..|:
  Rat   283 -NSCYSAGIAKLEEGDEIQLA-IPRENAQISRNGDD-TFFGALKL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egrNP_724878.2 TNF 278..413 CDD:238108 23/106 (22%)
Tnfsf13bXP_006253542.1 TNF 186..322 CDD:238108 23/106 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15151
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.